Skip to main content

Table 1 Numbers of primary tumor and normal tissue samples

From: A pan-cancer analysis of the clinical and genetic portraits of somatostatin receptor expressing tumor as a potential target of peptide receptor imaging and therapy

Cancer subtypesACCBLCABRCACESCCHOLCOADDLBCESCAGBMHNSCKICHKIRCKIRPLGGLIHCLUAD
 794141127304365034818415750266543290514371540
 019112394101354425723205059
Cancer subtypesLUSCMESOOVPAADPCPGPRADREADSARCSKCMSTADTGCTTHCATHYMUCECUCSUVM
 504874221781795051662591034151505051205535780
 5100435210213705923500